missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DDOST Partial ORF (NP_005207, 328 a.a. - 427 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00001650-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16197114

  • 458.00€ / 25 microgramos


Fecha estimada de envío
22-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: TDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP
Especificaciones

Especificaciones

NP_005207
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYP
RUO
DDOST
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1650
DDOST (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AGE-R1|KIAA0115|MGC2191|OK/SW-cl.45|OST|OST48|WBP1
DDOST
Yes
Videos
Documentos