missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CYP24A1 Partial ORF (NP_000773, 415 a.a. - 514 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00001591-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16196984

  • 458.00€ / 25 microgramos


Fecha estimada de envío
22-10-2020
Añadir a la cesta

Description

Description

Sequence: LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
Specifications

Specifications

NP_000773
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
RUO
CYP24A1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1591
CYP24A1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CP24|CYP24|MGC126273|MGC126274|P450-CC24
CYP24A1
Yes
Videos
Documents