missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CXCR4 Partial ORF (AAH20968, 1 a.a. - 46 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00007852-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16108015

  • 341.70€ / 10 microgramos
Envío estimado: 12-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Sequence: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
Especificaciones

Especificaciones

AAH20968
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
30.8kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
RUO
CXCR4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
7852
CXCR4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD184/D2S201E/FB22/HM89/HSY3RR/LAP3/LCR1/LESTR/NPY3R/NPYR/NPYRL/NPYY3R/WHIM
CXCR4
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales