missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CTHRC1 Partial ORF (NP_612464, 32 a.a. - 141 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00115908-Q01.25ug

Additional Details : Peso : 0.00010kg

 Lernen Sie weitere Varianten dieses

Artikelnummer. 16101507

  • 518.16€ / 25 microgramos
Envío estimado: 03-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Beschreibung

Beschreibung

CTHRC1 is specifically expressed in vascular calcifications of carotid artery lesions and may contribute to vascular remodeling of injured arteries (Pyagay et al., 2005 [PubMed 15618538]).[supplied by OMIM]

Sequence: EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF
Spezifikation

Spezifikation

NP_612464
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF
RUO
CTHRC1
Yes
wheat germ expression system
Liquid
115908
CTHRC1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CTHRC1
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote