missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CTCFL Partial ORF (NP_542185, 193 a.a. - 293 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00140690-Q01.25ug

Additional Details : Peso : 0.00010kg

 View more versions of this product

Product Code. 16191947

  • 467.00€ / 25 microgramos


Fecha estimada de envío
15-02-2021
Add to basket

Description

Description

Sequence: AERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKT
Specifications

Specifications

NP_542185
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.85kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKT
RUO
CTCFL
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
140690
CTCFL (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BORIS|CTCF-T|MGC163358|dJ579F20.2
CTCFL
Yes
Videos
SDS
Documents