missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CREB3L4 Partial ORF (NP_570968.1, 324 a.a. - 395 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00148327-Q02.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16192077

  • 467.00€ / 25 microgramos


Fecha estimada de envío
17-02-2021
Añadir a la cesta

Descripción

Descripción

Sequence: SEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPPGAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM
Especificaciones

Especificaciones

NP_570968.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.66kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPPGAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM
RUO
CREB3L4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
148327
CREB3L4 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AIBZIP|ATCE1|CREB3|CREB4|JAL|hJAL
CREB3L4
Yes
Videos
SDS
Documentos