missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CPOX Partial ORF (NP_000088, 356 a.a. - 453 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00001371-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16196604

  • 341.70€ / 10 microgramos
Envío estimado: 10-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Coproporphyrinogen oxidase (EC 1.3.3.3) is the sixth enzyme of the heme biosynthetic pathway. This soluble protein is localized in the intermembrane space of mitochondria and catalyzes the stepwise oxidative decarboxylation of the heme precursor coproporphyrinogen III to protoporphyrinogen IX via the tricarboxylic intermediate harderoporphyrinogen.[supplied by OMIM]

Sequence: SCARAVVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENSKEAEILEVLRHPRDWV
Especificaciones

Especificaciones

NP_000088
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SCARAVVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENSKEAEILEVLRHPRDWV
RUO
CPOX
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1371
CPOX (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CPO/CPX/HCP
CPOX
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales