missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human COPS3 Partial ORF (NP_003644, 324 a.a. - 422 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008533-Q01.10ug

Additional Details : Peso : 0.00010kg

 View more versions of this product

Product Code. 16108755

  • 341.70€ / 10 microgramos
Envío estimado: 04-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Description

Description

The protein encoded by this gene possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq]

Sequence: SRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSY
Specifications

Specifications

NP_003644
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSY
RUO
COPS3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
8533
COPS3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CSN3/SGN3
COPS3
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers