missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CENPF Partial ORF (NP_057427, 121 a.a. - 220 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Especificaciones
| Número de acceso | NP_057427 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 1063 |
| Peso molecular | 36.74kDa |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
16103121
|
Abnova™
H00001063-Q01.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 30-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
16193111
|
Abnova™
H00001063-Q01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 30-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
This gene encodes a protein that associates with the centromere-kinetochore complex. The protein is a component of the nuclear matrix during the G2 phase of interphase. In late G2 the protein associates with the kinetochore and maintains this association through early anaphase. It localizes to the spindle midzone and the intracellular bridge in late anaphase and telophase, respectively, and is thought to be subsequently degraded. The localization of this protein suggests that it may play a role in chromosome segregation during mitotis. It is thought to form either a homodimer or heterodimer. Autoantibodies against this protein have been found in patients with cancer or graft versus host disease. [provided by RefSeq]
Sequence: CKSELERSQQAAQSADVSLNPCNTPQKIFTTPLTPSQYYSGSKYEDLKEKYNKEVEERKRLEAEVKALQAKKASQTLPQATMNHRDIARHQASSSVFSWQEspecificaciones
| NP_057427 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CENF/PRO1779/hcp-1 | |
| CENPF | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 1063 | |
| CENPF (Human) Recombinant Protein (Q01) | |
| CKSELERSQQAAQSADVSLNPCNTPQKIFTTPLTPSQYYSGSKYEDLKEKYNKEVEERKRLEAEVKALQAKKASQTLPQATMNHRDIARHQASSSVFSWQ | |
| RUO | |
| CENPF | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |