missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CDH23 Partial ORF (NP_071407, 29 a.a. - 114 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00064072-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16103353

  • 341.70€ / 10 microgramos
Envío estimado: 04-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is a large, single-pass transmembrane protein composed of an extracellular domain containing 27 repeats that show significant homology to the cadherin ectodomain. Expressed in the neurosensory epithelium, the protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region containing the human deafness loci DFNB12 and USH1D. Usher syndrome 1D and nonsyndromic autosomal recessive deafness DFNB12 are caused by allelic mutations of this cadherin-like gene. Two alternative splice variants have been identified that encode different isoforms. Additional variants have been observed but their full-length nature has not been determined. [provided by RefSeq]

Sequence: PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVI
Especificaciones

Especificaciones

NP_071407
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.2kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVI
RUO
CDH23
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
64072
CDH23 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DFNB12/DKFZp434P2350/FLJ00233/FLJ36499/KIAA1774/KIAA1812/MGC102761/USH1D
CDH23
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales