missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CD3D Full-length ORF (NP_000723.1, 1 a.a. - 171 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00000915-P01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq]
Sequence: MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKEspecificaciones
| NP_000723.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 45.3kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CD3-DELTA/T3D | |
| CD3D | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 915 | |
| CD3D (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK | |
| RUO | |
| CD3D | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
Seguridad y manipulación
Nombre del producto
Palabra de advertencia
Clasificación
Indicaciones de peligro
Consejos de prudencia
Otros peligros
- CD3D (Human) Recombinant Protein (P01)
Palabra de advertencia
- Atención
Clasificación
- Toxicidad aguda Categoría 4
- Lesión ocular grave/irritación ocular Categoría 2
- Corrosión o irritación cutáneas Categoría 2
Indicaciones de peligro
- H302-Nocivo en caso de ingestión.
- H312-Nocivo en contacto con la piel.
- H319-Provoca irritación ocular grave.
Consejos de prudencia
- P102-Mantener fuera del alcance de los niños.
- P103-Leer la etiqueta antes del uso.
- P233-Mantener el recipiente herméticamente cerrado.
- P264-Lavarse concienzudamente tras la manipulación.
- P270-No comer, beber ni fumar durante su utilización.
- P280-Llevar guantes/prendas/gafas/máscara de protección.
- P301+P310-EN CASO DE INGESTIÓN: Llamar inmediatamente a un CENTRO DE TOXICOLOG A/médico/.
- P303+P361+P353-EN CASO DE CONTACTO CON LA PIEL (o el pelo): Quitar inmediatamente todas las prendas contaminadas. Aclararse la piel con agua/ducharse.
- P304+P340-EN CASO DE INHALACIÓN: Transportar a la persona al aire libre y mantenerla en una posición que le facilite la respiración.
- P404-Almacenar en un recipiente cerrado.
- P501b-Eliminar el contenido/el recipiente en conforme a la reglamentación local/regional/nacional/internacional.
Otros peligros
- MIXTURE LIST-Contém: tris-HCl, reduced glutathione