missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CD3D Full-length ORF (NP_000723.1, 1 a.a. - 171 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00000915-P01.25ug

Detalles adicionales : Peso : 0.00010kg


 Ver más versiones de este producto

Código de producto. 16102771

  • 518.16€ / 25 microgramos
Envío estimado: 07-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined. [provided by RefSeq]

Sequence: MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Especificaciones

Especificaciones

NP_000723.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
45.3kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD3-DELTA/T3D
CD3D
Yes
wheat germ expression system
Liquid
915
CD3D (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
RUO
CD3D
Wheat Germ (in vitro)
GST
Videos
Seguridad y manipulación

Seguridad y manipulación

Nombre del producto
  • CD3D (Human) Recombinant Protein (P01)

Palabra de advertencia
  • Atención

Clasificación
  • Toxicidad aguda Categoría 4
  • Lesión ocular grave/irritación ocular Categoría 2
  • Corrosión o irritación cutáneas Categoría 2

Indicaciones de peligro
  • H302-Nocivo en caso de ingestión.
  • H312-Nocivo en contacto con la piel.
  • H319-Provoca irritación ocular grave.

Consejos de prudencia
  • P102-Mantener fuera del alcance de los niños.
  • P103-Leer la etiqueta antes del uso.
  • P233-Mantener el recipiente herméticamente cerrado.
  • P264-Lavarse concienzudamente tras la manipulación.
  • P270-No comer, beber ni fumar durante su utilización.
  • P280-Llevar guantes/prendas/gafas/máscara de protección.
  • P301+P310-EN CASO DE INGESTIÓN: Llamar inmediatamente a un CENTRO DE TOXICOLOG A/médico/.
  • P303+P361+P353-EN CASO DE CONTACTO CON LA PIEL (o el pelo): Quitar inmediatamente todas las prendas contaminadas. Aclararse la piel con agua/ducharse.
  • P304+P340-EN CASO DE INHALACIÓN: Transportar a la persona al aire libre y mantenerla en una posición que le facilite la respiración.
  • P404-Almacenar en un recipiente cerrado.
  • P501b-Eliminar el contenido/el recipiente en conforme a la reglamentación local/regional/nacional/internacional.

Otros peligros
  • MIXTURE LIST-Contém: tris-HCl, reduced glutathione

SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales