missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CCL16 Partial ORF (NP_004581.1, 25 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00006360-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16195035

  • 302.00€ / 10 microgramos


Fecha estimada de envío
26-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: PKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Especificaciones

Especificaciones

NP_004581.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.3kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
RUO
CCL16
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6360
CCL16 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CKb12|HCC-4|ILINCK|LCC-1|LEC|LMC|MGC117051|Mtn-1|NCC-4|NCC4|SCYA16|SCYL4
CCL16
Yes
Videos
Documentos