missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CAMK1G Partial ORF (AAH32787, 371 a.a. - 476 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00057172-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16192573

  • 310.00€ / 10 microgramos


Fecha estimada de envío
16-02-2021
Añadir a la cesta

Descripción

Descripción

Sequence: TQLPCQHGRRPTAPGGRSLNCLVNGSLHISSSLVPMHQGSLAAGPCGCCSSCLNIGSKGKSSYCSEPTLLKKANKKQNFKSEVMVPVKASGSSHCRAGQTGVCLIM
Especificaciones

Especificaciones

AAH32787
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.29kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TQLPCQHGRRPTAPGGRSLNCLVNGSLHISSSLVPMHQGSLAAGPCGCCSSCLNIGSKGKSSYCSEPTLLKKANKKQNFKSEVMVPVKASGSSHCRAGQTGVCLIM
RUO
CAMK1G
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
57172
CAMK1G (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CLICKIII|VWS1|dJ272L16.1
CAMK1G
Yes
Videos
SDS
Documentos