missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human C9orf95 Partial ORF (NP_060351.1, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00054981-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16197816

  • 302.00€ / 10 microgramos


Fecha estimada de envío
21-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAE
Especificaciones

Especificaciones

NP_060351.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAE
RUO
C9orf95
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
54981
C9orf95 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ20559|NRK1|RP11-235O14.2|bA235O14.2
C9orf95
Yes
Videos
Documentos