missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BICD1 Partial ORF (NP_001705, 1 a.a. - 70 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70€ - 518.16€

Especificaciones

Nombre BICD1 (Human) Recombinant Protein (Q01)
Recombinante Yes
Para utilizar con (aplicación) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Peso molecular 33.44kDa
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16105224
Ver documentos Detalles de la promoción
Abnova™
H00000636-Q01.10UG
10 ug
341.70€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 08-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16115224
Ver documentos Detalles de la promoción
Abnova™
H00000636-Q01.25UG
25 ug
518.16€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 08-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

This gene is one of two human homologs of Drosophila bicaudal-D. It has been implicated in COPI-independent membrane transport from the Golgi apparatus to the endoplasmic reticulum. Two alternative splice variants have been described. Other alternative splice variants that encode different protein isoforms have been described but their full-length nature has not been determined. [provided by RefSeq]

Sequence: MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYDSLKQELEQLK
Especificaciones

Especificaciones

BICD1 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
33.44kDa
SDS
Product Certifications