missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BHLHB3 Partial ORF (NP_110389, 203 a.a. - 282 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00079365-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16199986

  • 302.00€ / 10 microgramos


Fecha estimada de envío
22-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKL
Especificaciones

Especificaciones

NP_110389
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.54kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKL
RUO
BHLHE41
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
79365
BHLHB3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BHLHB3|DEC2|SHARP-1|SHARP1
BHLHE41
Yes
Videos
Documentos