Learn More
Abnova™ Human ASCL1 Partial ORF (NP_004307.2, 76 a.a. - 170 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00000429-Q03.10ug
Detalles adicionales : Peso : 0.02000kg
Descripción
This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq]
Sequence: GGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALEspecificaciones
NP_004307.2 | |
Liquid | |
429 | |
ASCL1 (Human) Recombinant Protein (Q03) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ASH1/HASH1/MASH1/bHLHa46 | |
ASCL1 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.19kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
GGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRAL | |
RUO | |
ASCL1 | |
Wheat Germ (in vitro) | |
GST |