missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARPC4 Full-length ORF (NP_001020130.1, 1 a.a. - 78 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00010093-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16104482

  • 341.70€ / 10 microgramos
Envío estimado: 27-12-2021

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p20 subunit, has yet to be determined. Three transcript variants encoding two distinct isoforms have been found for this gene. [provided by RefSeq]

Sequence: MRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHKLVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF
Especificaciones

Especificaciones

NP_001020130.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
ARPC4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10093
ARPC4 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARC20/MGC13544/p20-Arc
ARPC4
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales