missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARL6IP5 Partial ORF (NP_006398, 1 a.a. - 64 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00010550-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16102776

  • 518.16€ / 25 microgramos
Envío estimado: 27-12-2021

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport. [provided by RefSeq]

Sequence: MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPF
Especificaciones

Especificaciones

NP_006398
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.78kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPF
RUO
ARL6IP5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10550
ARL6IP5 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DERP11/GTRAP3-18/HSPC127/JWA/PRAF3/addicsin/hp22/jmx
ARL6IP5
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales