missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ARHGDIA Partial ORF (AAH16031.1, 59 a.a. - 137 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00000396-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al., 1993 [PubMed 8262133]).[supplied by OMIM]
Sequence: VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVEspecificaciones
| AAH16031.1 | |
| Liquid | |
| 396 | |
| ARHGDIA (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GDIA1/MGC117248/RHOGDI/RHOGDI-1 | |
| ARHGDIA | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.43kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGV | |
| RUO | |
| ARHGDIA | |
| Wheat Germ (in vitro) | |
| GST |