missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human AMY1A Partial ORF (NP_001008222, 172 a.a. - 245 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00000276-Q01.10ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq]
Sequence: VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIEspecificaciones
| NP_001008222 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.88kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI | |
| RUO | |
| AMY1A | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 276 | |
| AMY1A (Human) Recombinant Protein (Q01) | |
| 10 μg | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AMY1/AMY1B | |
| AMY1A | |
| Recombinant | |
| wheat germ expression system |