missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ALOX12P2 Full-length ORF (AAH41851.1, 1 a.a. - 256 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00000245-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16101511

  • 341.70€ / 10 microgramos
Envío estimado: 03-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Sequence: MVKLRKHNVLLSLDWFCKWISVQGPGTQGAAFFPCYRWVQGHGIICLPEGTARTVSDDPQNLFKKYREQELEERRWGSWKDGLILPIAGNRQPDLPRDERFLEDKDLDFNVSLAKGLKDLAIKGTLDFINCVKRLEDFKKIFPHGKTVLAERVYDSWKNDAFFGYQFLNGANPMLLRCTSRLPACLVLPPGMEDLKTQLEKELQAGSLFEVDFSLLDGVKPNVIIFKQQCVAAPLVMLKLQPDGGLLPMVIQLQPP
Especificaciones

Especificaciones

AAH41851.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
55.5kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
ALOX12P2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
245
ALOX12P2 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ALOX12E/MGC43625
ALOX12P2
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales