missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ALG13 Full-length ORF (NP_060936.1, 1 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for Array, ELISA, WB-Re

Marca:  Abnova™ H00079868-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16104583

  • 341.70€ / 10 microgramos
Envío estimado: 27-12-2021

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Asparagine (N)-glycosylation is an essential modification that regulates protein folding and stability. ALG13 and ALG14 (MIM 612866) constitute the UDP-GlcNAc transferase, which catalyzes a key step in endoplasmic reticulum N-linked glycosylation (Averbeck et al., 2007 [PubMed 17686769]).[supplied by OMIM]

Sequence: MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK
Especificaciones

Especificaciones

NP_060936.1
Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
44.6kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
ALG13
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
79868
ALG13 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CXorf45/FLJ23018/GLT28D1/MDS031/MGC12423/YGL047W
ALG13
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales