missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human AKR1C1 Partial ORF (AAH20216, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00€ - 508.00€
Especificaciones
| Número de acceso | AAH20216 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 1645 |
| Peso molecular | 37.84kDa |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
16113971
|
Abnova™
H00001645-Q01.25UG |
25 ug |
508.00€
25 microgramos |
Fecha estimada de envío: 31-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
16103971
|
Abnova™
H00001645-Q01.10UG |
10 ug |
335.00€
10 microgramos |
Fecha estimada de envío: 31-05-2024 Inicie sesión para ver el stock |
Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Descripción
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq]
Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYEspecificaciones
| AAH20216 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.84kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| 2-ALPHA-HSD/20-ALPHA-HSD/C9/DD1/DDH/DDH1/H-37/HAKRC/MBAB/MGC8954 | |
| AKR1C1 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 1645 | |
| AKR1C1 (Human) Recombinant Protein (Q01) | |
| MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDY | |
| RUO | |
| AKR1C1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |