missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AGPS Partial ORF (NP_003650, 559 a.a. - 658 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00008540-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16198765

  • 302.00€ / 10 microgramos


Fecha estimada de envío
23-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: FAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL
Especificaciones

Especificaciones

NP_003650
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
FAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL
RUO
AGPS
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
8540
AGPS (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ADAP-S|ADAS|ADHAPS|ADPS|ALDHPSY|DKFZp762O2215|FLJ99755
AGPS
Yes
Videos
Documentos