missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ADAM33 Full-length ORF (AAH62663.1, 1 a.a. - 85 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00080332-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16104973

  • 341.70€ / 10 microgramos
Envío estimado: 27-12-2021

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: MGWRPRRARGTPLLLLLLLLLLWPVPGAGVLQGHIPGQPVTPHWVLDGQPWRTVSLEEPVSKPDMGLVALEAEGQELLLELEKNQ
Especificaciones

Especificaciones

AAH62663.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.8kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
ADAM33
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
80332
ADAM33 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C20orf153/DJ964F7.1/DKFZp434K0521/FLJ35308/FLJ36751/MGC149823/MGC71889
ADAM33
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales