missing translation for 'onlineSavingsMsg'
Learn More

HIPK3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP1-84950

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18214177

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

HIPK3 Polyclonal specifically detects HIPK3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

HIPK3
Polyclonal
Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Androgen receptor-interacting nuclear protein kinase, DYRK6Fas-interacting serine/threonine-protein kinase, EC 2.7.11.1, FIST, FIST3ANPK, homeodomain interacting protein kinase 3, homeodomain-interacting protein kinase 3, PKYHomolog of protein kinase YAK1, YAK1
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
HIPK3
This antibody was developed against Recombinant Protein corresponding to amino acids:SHLNSCDTNNHNKTSLLRPVASSSTATLTANFTKIGTLRSQALTTSAHSVVHHGIPLQAGTAQFGCGDAFQQTLIICPPAIQGIPA
0.1 mL
Protein Kinase
10114
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only