missing translation for 'onlineSavingsMsg'
Learn More

GRF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-58306

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214922

  • 471.91€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

GRF2 Polyclonal specifically detects GRF2 in Human samples. It is validated for Western Blot.
Especificaciones

Especificaciones

GRF2
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
C3GGRF2guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene), CRK SH3-binding GNRP, DKFZp781P1719, Guanine nucleotide-releasing factor 2, Protein C3G, Rap guanine nucleotide exchange factor (GEF) 1, rap guanine nucleotide exchange factor 1
Rabbit
121 kDa
100 μL
Signal Transduction
2889
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q13905
RAPGEF1
Synthetic peptides corresponding to RAPGEF1(Rap guanine nucleotide exchange factor (GEF) 1) The peptide sequence was selected from the C terminal of RAPGEF1 (NP_005303). Peptide sequence LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK.
Affinity purified
RUO
Primary
Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 93%.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only