missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FLT3 (Human) Recombinant Protein

Human FLT3 partial ORF ( NP_004110, 91 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00002322-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16108254

  • 341.70€ / 10 microgramos
Envío estimado: 20-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP
Especificaciones

Especificaciones

NP_004110
fms-related tyrosine kinase 3
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLT3
GST
2322
Wheat germ expression system
10 μg
CD135, FLK2, STK1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales