missing translation for 'onlineSavingsMsg'
Learn More

ERP29 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-88396

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18213377

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

ERP29 Polyclonal specifically detects ERP29 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

ERP29
Polyclonal
Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
P30040
ERP29
This antibody was developed against Recombinant Protein corresponding to amino acids: ALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLD
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
C12orf8chromosome 12 open reading frame 8, endoplasmic reticulum lumenal protein ERp28, endoplasmic reticulum protein 29, Endoplasmic reticulum resident protein 28, endoplasmic reticulum resident protein 29, ERp28Endoplasmic reticulum resident protein 31, ERp29, ERp31ERP28, PDIA9, PDI-DB, protein disulfide isomerase family A, member 9
Rabbit
29 kDa
0.1 mL
Core ESC Like Genes, Membrane Trafficking and Chaperones, Stem Cell Markers
10961
Human, Rat
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only