missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ERH (Human) Recombinant Protein

Human ERH full-length ORF ( AAH14301, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00002079-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16194651

  • 458.00€ / 25 microgramos


Fecha estimada de envío
21-10-2020
Añadir a la cesta

Descripción

Descripción

  • Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Especificaciones

Especificaciones

AAH14301
enhancer of rudimentary homolog (Drosophila)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ERH
GST
2079
Wheat germ expression system
25 μg
DROER, FLJ27340
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Documentos