missing translation for 'onlineSavingsMsg'
Learn More

Epsin 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-56896

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214171

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

Epsin 3 Polyclonal specifically detects Epsin 3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones

Especificaciones

Epsin 3
Polyclonal
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
EPS-15-interacting protein 3, epsin 3, epsin-3, FLJ20778, MGC129899
Rabbit
Affinity Purified
RUO
55040
Human
IgG
Immunocytochemistry, Immunofluorescence
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
EPN3
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGPSASSLVNLDSLVKAPQVAKTRNPFLTGLSAPSPTNPFGAGEPGRPTLNQMRT
100 μL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only