missing translation for 'onlineSavingsMsg'
Learn More

DNER Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-88665

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18216218

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

DNER Polyclonal specifically detects DNER in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Especificaciones

Especificaciones

DNER
Polyclonal
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
DNER
This antibody was developed against Recombinant Protein corresponding to amino acids:GNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKP
0.1 mL
Growth and Development, Neuronal Cell Markers
92737
Human
IgG
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
0.05mg/mL
Immunohistochemistry, Immunohistochemistry-Paraffin 1:10 - 1:20
bet, delta and Notch-like epidermal growth factor-related receptor, delta/notch-like EGF repeat containing, delta-notch-like EGF repeat-containing transmembrane, H_NH0150O02.1, UNQ26, WUGSC:H_NH0150O02.1
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only