missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ DNAJB5 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Marca:  Novus Biologicals™ NBP2-58535PEP

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214135

  • 242.97€ / 100 microlitros
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJB5. Source: E.coli Amino Acid Sequence: IDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS The DNAJB5 Recombinant Protein Antigen is derived from E. coli. The DNAJB5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Especificaciones

Especificaciones

25822
DNAJB5 Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4.
DnaJ (Hsp40) homolog, subfamily B, member 5, heat shock cognate 40, Heat shock protein cognate 40, Heat shock protein Hsp40-2, Heat shock protein Hsp40-3, HSC40, Hsc40dnaJ homolog subfamily B member 5, KIAA1045
Unlabeled
100μL
E.Coli
>80% by SDS-PAGE and Coomassie blue staining
Store at −20C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
DNAJB5
Recombinant Protein Antigen
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51701. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only