missing translation for 'onlineSavingsMsg'
Learn More

DNAH14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-55097

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18216272

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

DNAH14 Polyclonal specifically detects DNAH14 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones

Especificaciones

DNAH14
Polyclonal
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
C1orf67, chromosome 1 open reading frame 67, Dnahc14, dynein, axonemal, heavy chain 14, HL18, HL-18
Rabbit
Affinity Purified
RUO
127602
Human
IgG
Immunocytochemistry, Immunofluorescence
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
DNAH14
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TGKLNAKRIKTEKSRSFLYHHLFLADDLFQTCLVYIRGLCEDAINLKNYNDHENNLSAICLVKLDSSRTYSLDEFCEEQLQQAT
100 μL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only