missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ DCC Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Marca:  Novus Biologicals™ NBP2-56793PEP

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214802

  • 242.97€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCC. Source: E.coli Amino Acid Sequence: GDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSN The DCC Recombinant Protein Antigen is derived from E. coli. The DCC Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Especificaciones

Especificaciones

1630
DCC Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4.
Colorectal cancer suppressor, CRC18, CRCR1, deleted in colorectal cancer protein, deleted in colorectal carcinoma, IGDCC1colorectal tumor suppressor, Immunoglobulin superfamily DCC subclass member 1, immunoglobulin superfamily, DCC subclass, member 1, net
Unlabeled
100μL
E.coli
>80% by SDS-PAGE and Coomassie blue staining
Store at −20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
DCC
Recombinant Protein Antigen
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52019. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only.