missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CYP4A11 (Human) Recombinant Protein

Human CYP4A11 full-length ORF ( AAH22851, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00001579-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16103851

  • 508.00€ / 25 microgramos
Envío estimado: 30-12-2021

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQSPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFRHWQRAQHSRHLP
Especificaciones

Especificaciones

AAH22851
cytochrome P450, family 4, subfamily A, polypeptide 11
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CYP4A11
GST
1579
Wheat germ expression system
25 μg
CP4Y, CYP4A2, CYP4AII
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales