missing translation for 'onlineSavingsMsg'
Learn More

Cylicin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP2-56428

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18215583

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

Cylicin 1 Polyclonal specifically detects Cylicin 1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

Cylicin 1
Polyclonal
Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
CYCL1, CYL, CYL1, cylicin 1, cylicin I, cylicin, basic protein of sperm head cytoskeleton 1, cylicin-1, multiple-band polypeptide I
Rabbit
Affinity Purified
RUO
1538
Human
IgG
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
CYLC1
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KKDSKKDDKKKDAKKNAESTEMESDLELKKDKKHSKEKKGSKKDIKKDARKDTESTDAEFDESSKTGFKTSTKIKGSDTESEESLYKP
100 μL
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only