missing translation for 'onlineSavingsMsg'
Learn More

CSN7b Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-85433

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18214818

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 21-08-2024
para ver el stock

Descripción

Descripción

CSN7b Polyclonal specifically detects CSN7b in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

CSN7b
Polyclonal
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:10 - 1:20
Arabidopsis, homolog) subunit 7B, COP9 constitutive photomorphogenic homolog subunit 7B (Arabidopsis), COP9 signalosome complex subunit 7b, CSN7BMGC111077, FLJ12612, Signalosome subunit 7b
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
COPS7B
This antibody was developed against Recombinant Protein corresponding to amino acids:GELLELANVQELAEGANAAYLQLLNLFAYGTYPDYIANKESLPELSTAQQNKLKHLTIVSLASRMKCIPYSV
0.1 mL
Growth and Development, Neuronal Cell Markers, Neurotransmission, Signal Transduction, Transcription Factors and Regulators
64708
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only