missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ COX4I1 (Human) Recombinant Protein

Human COX4I1 full-length ORF ( AAH08704, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00001327-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16103421

  • 518.16€ / 25 microgramos
Envío estimado: 07-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Especificaciones

Especificaciones

AAH08704
cytochrome c oxidase subunit IV isoform 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
COX4I1
GST
1327
Wheat germ expression system
25 μg
COX4, COXIV, MGC72016
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales