missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CORIN (Human) Recombinant Protein
Human CORIN partial ORF ( NP_006578, 616 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00010699-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
- Sequence: CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA
Especificaciones
| NP_006578 | |
| corin, serine peptidase | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CORIN | |
| GST |
| 10699 | |
| Wheat germ expression system | |
| 10 μg | |
| ATC2, CRN, Lrp4, MGC119742, TMPRSS10 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |