missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CORIN (Human) Recombinant Protein

Human CORIN partial ORF ( NP_006578, 616 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00010699-Q01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16103046

  • 341.70€ / 10 microgramos
Envío estimado: 03-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA
Especificaciones

Especificaciones

NP_006578
corin, serine peptidase
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CORIN
GST
10699
Wheat germ expression system
10 μg
ATC2, CRN, Lrp4, MGC119742, TMPRSS10
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales