missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ COPS8 (Human) Recombinant Protein
Human COPS8 full-length ORF ( AAH03090, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00010920-P01.25ug
Weitere Details : Peso : 0.00010kg
Beschreibung
- Sequence: MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Spezifikation
| AAH03090 | |
| COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis) | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| COPS8 | |
| GST |
| 10920 | |
| Wheat germ expression system | |
| 25 μg | |
| COP9, CSN8, MGC1297, MGC43256, SGN8 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |