missing translation for 'onlineSavingsMsg'
Learn More

CNTROB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-82834

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18216036

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

CNTROB Polyclonal specifically detects CNTROB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

CNTROB
Polyclonal
Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:50 - 1:200
centrobin, centrosomal BRCA2 interacting protein, centrosomal BRCA2 interacting protein, Centrosomal BRCA2-interacting protein, LIP8centrobin, LYST-interacting protein 8, LYST-interacting protein LIP8, PP1221
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
CNTROB
This antibody was developed against Recombinant Protein corresponding to amino acids:SQHSFQPLEPKPDLTSSTAGAFSALGAFHPDHRAERPFPEEDPGPDGEGLLKQGLPPAQLEGLKNFLHQLLETVPQNNEN
0.1 mL
Cell Cycle and Replication
116840
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only