missing translation for 'onlineSavingsMsg'
Learn More

CDK4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-58877

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18213944

  • 484.87€ / 100 microlitros
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

CDK4 Polyclonal specifically detects CDK4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Especificaciones

Especificaciones

CDK4
Polyclonal
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Cell division protein kinase 4, CMM3, cyclin-dependent kinase 4, EC 2.7.11, EC 2.7.11.22, melanoma cutaneous malignant, 3, MGC14458, PSK-J3cell division kinase 4
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunocytochemistry, Immunofluorescence
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
CDK4
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
100 μL
Cancer, Cell Cycle and Replication, Core ESC Like Genes, mTOR Pathway, Protein Kinase, Stem Cell Markers
1019
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only