missing translation for 'onlineSavingsMsg'
Learn More

CCDC44 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-88161

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18213696

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 19-08-2024
para ver el stock

Descripción

Descripción

CCDC44 Polyclonal specifically detects CCDC44 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

CCDC44
Polyclonal
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50
CCDC44translational activator of cytochrome c oxidase 1, clone HQ0477 PRO0477p, coiled-coil domain containing 44, Coiled-coil domain-containing protein 44, translational activator of mitochondrially encoded cytochrome c oxidase I, Translational activator of mitochondrially-encoded cytochrome c oxidase I
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
TACO1
This antibody was developed against Recombinant Protein corresponding to amino acids:SNSSHKCQADIRHILNKNGGVMAVGARHSFDKKGVIVVEVEDREKKAVNLERALEMAIEAGAEDVKETEDE
0.1 mL
metabolism
51204
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only