missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ C12orf73 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Marca:  Novus Biologicals™ NBP1-90536PEP

Detalles adicionales : Peso : 0.00970kg

Código de producto. 18215289

  • 242.97€ / 0.10 ml
Fecha estimada de envío: 14-08-2024
para ver el stock

Descripción

Descripción

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C12ORF73. The C12orf73 Recombinant Protein Antigen is derived from E. coli. The C12orf73 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-90536. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Especificaciones

Especificaciones

728568
Chromatography
0.5mg/mL
PBS and 1M Urea, pH 7.4.
BR, BRAWNIN, chromosome 12 open reading frame 73, FLJ13975, protein BRAWNIN, uncharacterized protein C12orf73
Unlabeled
C12orf73
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90536. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Human
>80%
Store at -20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
C12ORF73
23kDa
0.1mL
E.Coli
AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only