missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ATP1B3 (Human) Recombinant Protein

Human ATP1B3 full-length ORF ( AAH11835, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00000483-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16192011

  • 310.00€ / 10 microgramos


Fecha estimada de envío
15-02-2021
Añadir a la cesta

Descripción

Descripción

  • Sequence: MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Especificaciones

Especificaciones

AAH11835
ATPase, Na+/K+ transporting, beta 3 polypeptide
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ATP1B3
GST
483
Wheat germ expression system
10 μg
ATPB-3, CD298, FLJ29027
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos