missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ARHGDIB (Human) Recombinant Protein

Human ARHGDIB full-length ORF ( AAH09200, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00000397-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16191861

  • 310.00€ / 10 microgramos


Fecha estimada de envío
19-02-2021
Añadir a la cesta

Descripción

Descripción

  • Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Especificaciones

Especificaciones

AAH09200
Rho GDP dissociation inhibitor (GDI) beta
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARHGDIB
GST
397
Wheat germ expression system
10 μg
D4, GDIA2, GDID4, LYGDI, Ly-GDI, RAP1GN1, RhoGDI2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos