Abnova™ ARHGDIB (Human) Recombinant Protein

Name: Abnova&trade; ARHGDIB (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16101871
Price: 508.00 EUR

Human ARHGDIB full-length ORF ( AAH09200, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Marca: Abnova™ H00000397-P01.25ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16101871

Fecha estimada de envío: 31-05-2024
para ver el stock

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE

Especificaciones

Número de acceso	AAH09200
Nombre	Rho GDP dissociation inhibitor (GDI) beta
Pruebas de control de calidad	125% SDS-PAGE Stained with Coomassie Blue
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Símbolo de gen	ARHGDIB
Etiqueta de proteína	GST

ID de gen (Entrez)	397
Método de preparación	Wheat germ expression system
Cantidad	25 μg
Alias de gen	D4, GDIA2, GDID4, LYGDI, Ly-GDI, RAP1GN1, RhoGDI2
Especie	Wheat Germ (in vitro)
Tampón	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Sugerencias de productos

Descripción