missing translation for 'onlineSavingsMsg'
Learn More

Apc11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Bio-Techne NBP1-90140

Detalles adicionales : Peso : 0.00970kg

 Ver más versiones de este producto

Código de producto. 18215418

  • 484.87€ / 0.10 ml
Fecha estimada de envío: 14-08-2024
para ver el stock

Descripción

Descripción

Apc11 Polyclonal specifically detects Apc11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Especificaciones

Especificaciones

Apc11
Polyclonal
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
anaphase promoting complex subunit 11, anaphase promoting complex subunit 11 (yeast APC11 homolog), anaphase-promoting complex subunit 11, APC11 anaphase promoting complex subunit 11 homolog, APC11Hepatocellular carcinoma-associated RING finger protein, Apc11p, Cyclosome subunit 11, HSPC214, MGC882
Rabbit
Affinity Purified
RUO
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
ANAPC11
This antibody was developed against Recombinant Protein corresponding to amino acids:SPWCLDHSCDLFGITDQVSADGPRACRQGARRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVPPGMEVQGV
0.1 mL
Cell Cycle and Replication
51529
Human
IgG
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only